MGC42174 antibody (70R-1462)

Rabbit polyclonal MGC42174 antibody raised against the N terminal Of Mgc42174

Synonyms Polyclonal MGC42174 antibody, Anti-MGC42174 antibody, MGC-42174 antibody, MGC 42174 antibody, MGC-42174, MGC42174, MGC 42174
Specificity MGC42174 antibody was raised against the N terminal Of Mgc42174
Cross Reactivity Human
Applications IHC, WB
Immunogen MGC42174 antibody was raised using the N terminal Of Mgc42174 corresponding to a region with amino acids MSHPDYRMNLRPLGTPRGVSAVAGPHDIGASPGDKKSKNRSTRGKKKSIF
Assay Information MGC42174 Blocking Peptide, catalog no. 33R-6440, is also available for use as a blocking control in assays to test for specificity of this MGC42174 antibody

Images

Immunohistochemical staining using MGC42174 antibody (70R-1462)

MGC42174 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of intestinal villus (arrows) in Human Intestine. Magnification is at 400X

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 68 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of MGC42174 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance MGC42174 is a probable exonuclease.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunohistochemical staining using MGC42174 antibody (70R-1462) | MGC42174 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of intestinal villus (arrows) in Human Intestine. Magnification is at 400X
  • Western Blot analysis using MGC42174 antibody (70R-1462) | MGC42174 antibody (70R-1462) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: $275.00
Size: 100 ug
OR
Shipping
View Our Distributors