MGC45491 antibody (70R-4254)

Rabbit polyclonal MGC45491 antibody raised against the middle region of Mgc45491

Synonyms Polyclonal MGC45491 antibody, Anti-MGC45491 antibody, MGC45491, MGC-45491, , MGC 45491 antibody, MGC 45491, MGC-45491 antibody
Specificity MGC45491 antibody was raised against the middle region of Mgc45491
Cross Reactivity Human
Applications WB
Immunogen MGC45491 antibody was raised using the middle region of Mgc45491 corresponding to a region with amino acids CRPLRPLLGFRESDSAKPASLRLLQHTPSARRNYRIAGARLMRSNYPPPL
Assay Information MGC45491 Blocking Peptide, catalog no. 33R-1796, is also available for use as a blocking control in assays to test for specificity of this MGC45491 antibody


Western Blot analysis using MGC45491 antibody (70R-4254)

MGC45491 antibody (70R-4254) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 26 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MGC45491 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of MGC45491 protein has not been widely studied, and is yet to be fully elucidated.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using MGC45491 antibody (70R-4254) | MGC45491 antibody (70R-4254) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors