MGC50722 antibody (70R-4281)

Rabbit polyclonal MGC50722 antibody raised against the N terminal of MGC50722

Synonyms Polyclonal MGC50722 antibody, Anti-MGC50722 antibody, MGC 50722, MGC-50722, Hypothetical Mgc50722 antibody, MGC-50722 antibody, MGC 50722 antibody, MGC50722
Specificity MGC50722 antibody was raised against the N terminal of MGC50722
Cross Reactivity Human
Applications WB
Immunogen MGC50722 antibody was raised using the N terminal of MGC50722 corresponding to a region with amino acids DPPWAAPHVVGSDDLKEPGPWGKACSLPMWSTGPEARDGDSSVSSGRLSC
Assay Information MGC50722 Blocking Peptide, catalog no. 33R-2110, is also available for use as a blocking control in assays to test for specificity of this MGC50722 antibody


Western Blot analysis using MGC50722 antibody (70R-4281)

MGC50722 antibody (70R-4281) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 103 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MGC50722 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of MGC50722 protein is not widely studied, and is yet to be elucidated fully.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using MGC50722 antibody (70R-4281) | MGC50722 antibody (70R-4281) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors