MGC70863 antibody (70R-4813)

Rabbit polyclonal MGC70863 antibody raised against the N terminal of MGC70863

Synonyms Polyclonal MGC70863 antibody, Anti-MGC70863 antibody, MGC 70863 antibody, MGC70863, MGC 70863, MGC-70863, Similar To Rpl23Ap7 Protein antibody, MGC-70863 antibody
Specificity MGC70863 antibody was raised against the N terminal of MGC70863
Cross Reactivity Human
Applications WB
Immunogen MGC70863 antibody was raised using the N terminal of MGC70863 corresponding to a region with amino acids MSLTFRRPKTLRLRRQPRYPRKSTPRRNKLGHYAIIKFPLATESAVKKIE
Assay Information MGC70863 Blocking Peptide, catalog no. 33R-6469, is also available for use as a blocking control in assays to test for specificity of this MGC70863 antibody

Images

Western Blot analysis using MGC70863 antibody (70R-4813)

MGC70863 antibody (70R-4813) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 14 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MGC70863 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of MGC70863 protein is not widely studied, and is yet to be elucidated fully.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using MGC70863 antibody (70R-4813) | MGC70863 antibody (70R-4813) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors