MICA antibody (70R-6091)

Rabbit polyclonal MICA antibody raised against the N terminal of MICA

Synonyms Polyclonal MICA antibody, Anti-MICA antibody, MGC111087 antibody, PERB11.1 antibody, Mhc Class I Polypeptide-Related Sequence A antibody
Specificity MICA antibody was raised against the N terminal of MICA
Cross Reactivity Human
Applications WB
Immunogen MICA antibody was raised using the N terminal of MICA corresponding to a region with amino acids LHSLQEIRVCEIHEDNSTRSSQHFYYDGELFLSQNLETKEWTMPQSSRAQ
Assay Information MICA Blocking Peptide, catalog no. 33R-5029, is also available for use as a blocking control in assays to test for specificity of this MICA antibody

Images

Western Blot analysis using MICA antibody (70R-6091)

MICA antibody (70R-6091) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 43 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MICA antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance MICA is expressed on the cell surface, although unlike canonical class I molecules does not seem to associate with beta-2-microglobulin. It is thought that MICA functions as a stress-induced antigen that is broadly recognised by intestinal epithelial gamma delta T cells.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using MICA antibody (70R-6091) | MICA antibody (70R-6091) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors