MICAL1 Blocking Peptide (33R-10430)

A synthetic peptide for use as a blocking control in assays to test for specificity of MICAL1 antibody, catalog no. 70R-10397

Synonyms MICAL1 control peptide, MICAL1 antibody Blocking Peptide, Anti-MICAL1 Blocking Peptide, microtubule associated monoxygenase, calponin and LIM domain containing 1 Blocking Peptide, DKFZp434B1517 Blocking Peptide, FLJ11937 Blocking Peptide, FLJ21739 Blocking Peptide, MICAL Blocking Peptide, MICAL-1 Blocking Peptide, NICAL Blocking Peptide, MICAL1, MICAL-1, MICAL 1, MICAL-1 Blocking Peptide, MICAL 1 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues WQLDQELRGYMNREENLKTAADRQAEDQVLRKLVDLVNQRDALIRFQEER
Molecular Weight 107 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance MICAL1 may be a cytoskeletal regulator that connects NEDD9 to intermediate filaments.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: $130.00
Size: 100 ug
OR
Shipping
View Our Distributors