MIER2 antibody (70R-4353)

Rabbit polyclonal MIER2 antibody raised against the middle region of MIER2

Synonyms Polyclonal MIER2 antibody, Anti-MIER2 antibody, Mesoderm Induction Early Response 1 Family Member 2 antibody, KIAA1193 antibody, MIER-2 antibody, MIER 2, MIER-2, MIER2, MIER 2 antibody
Specificity MIER2 antibody was raised against the middle region of MIER2
Cross Reactivity Human
Applications WB
Immunogen MIER2 antibody was raised using the middle region of MIER2 corresponding to a region with amino acids RLRFNVKVIRDGLCAWSEEECRNFEHGFRVHGKNFHLIQANKVRTRSVGE
Assay Information MIER2 Blocking Peptide, catalog no. 33R-8048, is also available for use as a blocking control in assays to test for specificity of this MIER2 antibody


Western Blot analysis using MIER2 antibody (70R-4353)

MIER2 antibody (70R-4353) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 60 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MIER2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance MIER2 is a transcriptional repressor.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using MIER2 antibody (70R-4353) | MIER2 antibody (70R-4353) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors