Mitofusin 1 antibody (70R-4467)

Rabbit polyclonal Mitofusin 1 antibody raised against the middle region of MFN1

Synonyms Polyclonal Mitofusin 1 antibody, Anti-Mitofusin 1 antibody, hfzo1 antibody, Mitofusin -1, Mitofusin -1 antibody, Mitofusin 1, hfzo2 antibody, MGC41806 antibody, DKFZp762F247 antibody, Mitofusin 1 antibody, FLJ20693 antibody, MFN1 antibody, Mitofusin 1
Specificity Mitofusin 1 antibody was raised against the middle region of MFN1
Cross Reactivity Human
Applications WB
Immunogen Mitofusin 1 antibody was raised using the middle region of MFN1 corresponding to a region with amino acids QVDITQKQLEEEIARLPKEIDQLEKIQNNSKLLRNKAVQLENELENFTKQ
Assay Information Mitofusin 1 Blocking Peptide, catalog no. 33R-7768, is also available for use as a blocking control in assays to test for specificity of this Mitofusin 1 antibody


Western Blot analysis using Mitofusin 1 antibody (70R-4467)

Mitofusin 1 antibody (70R-4467) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 84 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MFN1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein encoded by this gene is a mediator of mitochondrial fusion. This protein and mitofusin 2 are homologs of the Drosophila protein fuzzy onion (Fzo). They are mitochondrial membrane proteins that interact with each other to facilitate mitochondrial targeting.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using Mitofusin 1 antibody (70R-4467) | Mitofusin 1 antibody (70R-4467) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors