Mitofusin 2 antibody (70R-6460)

Rabbit polyclonal Mitofusin 2 antibody raised against the N terminal of MFN2

Synonyms Polyclonal Mitofusin 2 antibody, Anti-Mitofusin 2 antibody, CMT2A2 antibody, CMT2A antibody, HSG antibody, KIAA0214 antibody, Mitofusin -2, MARF antibody, Mitofusin -2 antibody, Mitofusin 2 antibody, CPRP1 antibody, Mitofusin 2, Mitofusin 2, MFN2 antibody
Specificity Mitofusin 2 antibody was raised against the N terminal of MFN2
Cross Reactivity Human
Applications WB
Immunogen Mitofusin 2 antibody was raised using the N terminal of MFN2 corresponding to a region with amino acids STVINAMLWDKVLPSGIGHTTNCFLRVEGTDGHEAFLLTEGSEEKRSAKT
Assay Information Mitofusin 2 Blocking Peptide, catalog no. 33R-8895, is also available for use as a blocking control in assays to test for specificity of this Mitofusin 2 antibody

Images

Western Blot analysis using Mitofusin 2 antibody (70R-6460)

Mitofusin 2 antibody (70R-6460) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 86 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MFN2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance MFN2 is a mitochondrial membrane protein that participates in mitochondrial fusion and contributes to the maintenance and operation of the mitochondrial network. It is involved in the regulation of vascular smooth muscle cell proliferation, and it may play a role in the pathophysiology of obesity. Mutations in this gene cause Charcot-Marie-Tooth disease type 2A2, and hereditary motor and sensory neuropathy VI, which are both disorders of the peripheral nervous system. Defects in this gene have also been associated with early-onset stroke.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using Mitofusin 2 antibody (70R-6460) | Mitofusin 2 antibody (70R-6460) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors