MKI67IP antibody (70R-4649)

Rabbit polyclonal MKI67IP antibody

Synonyms Polyclonal MKI67IP antibody, Anti-MKI67IP antibody, Mki67 antibody, Fha Domain Interacting Nucleolar Phosphoprotein antibody, Nopp34 antibody, MKI67IP, NIFK antibody, MKIIP-67 antibody, MKIIP-67, MKIIP 67, MKIIP 67 antibody
Cross Reactivity Human
Applications WB
Immunogen MKI67IP antibody was raised using a synthetic peptide corresponding to a region with amino acids QPSYQSVKRYNRNRTLTQKLRMEERFKKKERLLRKKLAKKGIDYDFPSLI
Assay Information MKI67IP Blocking Peptide, catalog no. 33R-7686, is also available for use as a blocking control in assays to test for specificity of this MKI67IP antibody

Images

Western Blot analysis using MKI67IP antibody (70R-4649)

MKI67IP antibody (70R-4649) used at 0.25 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 32 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MKI67IP antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The MKI67IP protein interacts with the forkhead-associated domain of the Ki-67 antigen. The MKI67IP protein may bind RNA and may play a role in mitosis and cell cycle progression.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using MKI67IP antibody (70R-4649) | MKI67IP antibody (70R-4649) used at 0.25 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors