MKNK2 antibody (70R-5832)

Rabbit polyclonal MKNK2 antibody raised against the N terminal of MKNK2

Synonyms Polyclonal MKNK2 antibody, Anti-MKNK2 antibody, MKNK-2, MNK2 antibody, MKNK 2, Map Kinase Interacting Serine/Threonine Kinase 2 antibody, MKNK2, MKNK-2 antibody, GPRK7 antibody, MKNK 2 antibody
Specificity MKNK2 antibody was raised against the N terminal of MKNK2
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen MKNK2 antibody was raised using the N terminal of MKNK2 corresponding to a region with amino acids SDFGLQCSARPDMPASQPIDIPDAKKRGKKKKRGRATDSFSGRFEDVYQL
Assay Information MKNK2 Blocking Peptide, catalog no. 33R-8351, is also available for use as a blocking control in assays to test for specificity of this MKNK2 antibody

Images

Immunohistochemical staining using MKNK2 antibody (70R-5832)

MKNK2 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 51 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MKNK2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance MKNK2 may play a role in the response to environmental stress and cytokines. It appears to regulate transcription by phosphorylating EIF4E, thus increasing the affinity of this protein for the 7-methylguanosine-containing mRNA cap.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunohistochemical staining using MKNK2 antibody (70R-5832) | MKNK2 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X
  • Western Blot analysis using MKNK2 antibody (70R-5832) | MKNK2 antibody (70R-5832) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors