MKRN2 Blocking Peptide (33R-1071)

A synthetic peptide for use as a blocking control in assays to test for specificity of MKRN2 antibody, catalog no. 70R-2131

Synonyms MKRN2 control peptide, MKRN2 antibody Blocking Peptide, Anti-MKRN2 Blocking Peptide, Makorin Ring Finger Protein 2 Blocking Peptide, HSPC070 Blocking Peptide, RNF62 Blocking Peptide, MKRN2, MKRN-2, MKRN 2, MKRN-2 Blocking Peptide, MKRN 2 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues ACKYFEQGKGTCPFGSKCLYRHAYPDGRLAEPEKPRKQLSSQGTVRFFNS
Molecular Weight 47 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Members of the makorin family, including MKRN2, have a characteristic zinc finger composition that suggests that they are ribonucleoproteins.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: $130.00
Size: 100 ug
OR
Shipping
View Our Distributors