MLH1 antibody (70R-5690)

Rabbit polyclonal MLH1 antibody

Synonyms Polyclonal MLH1 antibody, Anti-MLH1 antibody, MLH 1, Mutl Homolog 1 Colon Cancer Nonpolyposis Type 2 antibody, MGC5172 antibody, MLH1, MLH 1 antibody, MLH-1, hMLH1 antibody, COCA2 antibody, FCC2 antibody, HNPCC antibody, HNPCC2 antibody, MLH-1 antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen MLH1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MIENCLDAKSTSIQVIVKEGGLKLIQIQDNGTGIRKEDLDIVCERFTTSK
Assay Information MLH1 Blocking Peptide, catalog no. 33R-6109, is also available for use as a blocking control in assays to test for specificity of this MLH1 antibody


Western Blot analysis using MLH1 antibody (70R-5690)

MLH1 antibody (70R-5690) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 84 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MLH1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene was identified as a locus frequently mutated in hereditary nonpolyposis colon cancer (HNPCC). It is a human homolog of the E. coli DNA mismatch repair gene mutL, consistent with the characteristic alterations in microsatellite sequences (RER+phenotype) found in HNPCC.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using MLH1 antibody (70R-5690) | MLH1 antibody (70R-5690) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors