MLKL antibody (70R-4173)

Rabbit polyclonal MLKL antibody raised against the N terminal of MLKL

Synonyms Polyclonal MLKL antibody, Anti-MLKL antibody, Mixed Lineage Kinase Domain-Like antibody, FLJ34389 antibody
Specificity MLKL antibody was raised against the N terminal of MLKL
Cross Reactivity Human
Applications WB
Immunogen MLKL antibody was raised using the N terminal of MLKL corresponding to a region with amino acids DVWKELSLLLQVEQRMPVSPISQGASWAQEDQQDADEDRRAFQMLRRDNE
Assay Information MLKL Blocking Peptide, catalog no. 33R-2230, is also available for use as a blocking control in assays to test for specificity of this MLKL antibody


Western Blot analysis using MLKL antibody (70R-4173)

MLKL antibody (70R-4173) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 54 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MLKL antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of MLKL protein is not widely studied, and is yet to be elucidated fully.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using MLKL antibody (70R-4173) | MLKL antibody (70R-4173) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors