MLSTD1 antibody (70R-6738)

Rabbit polyclonal MLSTD1 antibody raised against the C terminal Of Mlstd1

Synonyms Polyclonal MLSTD1 antibody, Anti-MLSTD1 antibody, MLSTD1, MLSTD-1 antibody, MLSTD-1, FLJ10462 antibody, MLSTD 1, MLSTD 1 antibody, FAR2 antibody
Specificity MLSTD1 antibody was raised against the C terminal Of Mlstd1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen MLSTD1 antibody was raised using the C terminal Of Mlstd1 corresponding to a region with amino acids WSTYNTEMLMSELSPEDQRVFNFDVRQLNWLEYIENYVLGVKKYLLKEDM
Assay Information MLSTD1 Blocking Peptide, catalog no. 33R-10019, is also available for use as a blocking control in assays to test for specificity of this MLSTD1 antibody

Images

Western Blot analysis using MLSTD1 antibody (70R-6738)

MLSTD1 antibody (70R-6738) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 59 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MLSTD1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance MLSTD1 catalyzes the reduction of fatty acyl-CoA to fatty alcohols. The preferred substrates are C16, C18, C18:1 and C18:2 but low activity can be observed with C10-C14 substrates.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using MLSTD1 antibody (70R-6738) | MLSTD1 antibody (70R-6738) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors