MMD2 antibody (70R-3313)

Rabbit polyclonal MMD2 antibody raised against the N terminal of MMD2

Synonyms Polyclonal MMD2 antibody, Anti-MMD2 antibody, MMD 2, Monocyte To Macrophage Differentiation-Associated 2 antibody, MMD-2 antibody, MMD2, MMD 2 antibody, FLJ37205 antibody, PAQR10 antibody, MMD-2
Specificity MMD2 antibody was raised against the N terminal of MMD2
Cross Reactivity Human
Applications WB
Immunogen MMD2 antibody was raised using the N terminal of MMD2 corresponding to a region with amino acids FAPRLLDFQKTKYARFMNHRVPAHKRYQPTEYEHAANCATHAFWIIPSIL
Assay Information MMD2 Blocking Peptide, catalog no. 33R-2846, is also available for use as a blocking control in assays to test for specificity of this MMD2 antibody


Western Blot analysis using MMD2 antibody (70R-3313)

MMD2 antibody (70R-3313) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 31 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MMD2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance MMD2 contains 1 COMM domain. The exact function of MMD2 remains unknown.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using MMD2 antibody (70R-3313) | MMD2 antibody (70R-3313) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors