MMEL1 antibody (70R-6249)

Rabbit polyclonal MMEL1 antibody raised against the middle region of MMEL1

Synonyms Polyclonal MMEL1 antibody, Anti-MMEL1 antibody, MGC119455 antibody, MMEL-1 antibody, MMEL1, NL2 antibody, SEP antibody, NL1 antibody, Membrane Metallo-Endopeptidase-Like 1 antibody, MGC119454 antibody, MMEL 1, MMEL-1, MMEL 1 antibody, MMEL2 antibody, NEPII antibody, MGC119456 antibody
Specificity MMEL1 antibody was raised against the middle region of MMEL1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen MMEL1 antibody was raised using the middle region of MMEL1 corresponding to a region with amino acids EVVVYGIPYLQNLENIIDTYSARTIQNYLVWRLVLDRIGSLSQRFKDTRV
Assay Information MMEL1 Blocking Peptide, catalog no. 33R-2809, is also available for use as a blocking control in assays to test for specificity of this MMEL1 antibody

Images

Western Blot analysis using MMEL1 antibody (70R-6249)

MMEL1 antibody (70R-6249) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 88 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MMEL1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance MMEL1 is a member of the neutral endopeptidase (NEP) or membrane metallo-endopeptidase (MME) family. Family members play important roles in pain perception, arterial pressure regulation, phosphate metabolism and homeostasis.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using MMEL1 antibody (70R-6249) | MMEL1 antibody (70R-6249) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors