MMP13 antibody (70R-5295)

Rabbit polyclonal MMP13 antibody

Synonyms Polyclonal MMP13 antibody, Anti-MMP13 antibody, MMP 13, MMP 13 antibody, MMP-13 antibody, CLG3 antibody, Collagenase 3 antibody, MMP 13 antibody, MMP-13 antibody, MMP-13, Matrix Metallopeptidase 13 antibody, MMP13
Cross Reactivity Human
Applications WB
Immunogen MMP13 antibody was raised using a synthetic peptide corresponding to a region with amino acids HFMLPDDDVQGIQSLYGPGDEDPNPKHPKTPDKCDPSLSLDAITSLRGET
Assay Information MMP13 Blocking Peptide, catalog no. 33R-3728, is also available for use as a blocking control in assays to test for specificity of this MMP13 antibody

Images

Western Blot analysis using MMP13 antibody (70R-5295)

MMP13 antibody (70R-5295) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 42 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MMP13 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Proteins of the matrix metalloproteinase (MMP) family are involved in the Breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using MMP13 antibody (70R-5295) | MMP13 antibody (70R-5295) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors