MMP20 antibody (70R-7198)

Rabbit polyclonal MMP20 antibody raised against the middle region of MMP20

Synonyms Polyclonal MMP20 antibody, Anti-MMP20 antibody, Matrix Metallopeptidase 20 antibody, MMP20, MMP 20 antibody, MMP 20, MMP-20 antibody, MMP-20, MMP-20 antibody
Specificity MMP20 antibody was raised against the middle region of MMP20
Cross Reactivity Human
Applications WB
Immunogen MMP20 antibody was raised using the middle region of MMP20 corresponding to a region with amino acids AAVYLREPQKTLFFVGDEYYSYDERKRKMEKDYPKNTEEEFSGVNGQIDA
Assay Information MMP20 Blocking Peptide, catalog no. 33R-1063, is also available for use as a blocking control in assays to test for specificity of this MMP20 antibody

Images

Western blot analysis using MMP20 antibody (70R-7198)

Tissue analyzed: Human Fetal Muscle; Antibody Dilution: 1.0ug/ml

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 43 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MMP20 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Proteins of the matrix metalloproteinase (MMP) family are involved in the Breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. MMP20 degrades amelogenin, the major protein component of dental enamel matrix, and so the protein is thought to play a role in tooth enamel formation. A mutation in the gene encoding MMP20, which alters the normal splice pattern and results in premature termination of the encoded protein, has been associated with amelogenesis imperfecta.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western blot analysis using MMP20 antibody (70R-7198) | Tissue analyzed: Human Fetal Muscle; Antibody Dilution: 1.0ug/ml
  • Western blot analysis using MMP20 antibody (70R-7198) | Recommended MMP20 Antibody Titration: 0.2-1 ug/ml

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors