MMP23B antibody (70R-6358)

Rabbit polyclonal MMP23B antibody raised against the N terminal of MMP23B

Synonyms Polyclonal MMP23B antibody, Anti-MMP23B antibody, MMP22 antibody, MIFR antibody, MMPB-23, MMPB-23 antibody, MMPB 23 antibody, MMPB 23, MMP23B, MIFR-1 antibody, Matrix Metallopeptidase 23B antibody
Specificity MMP23B antibody was raised against the N terminal of MMP23B
Cross Reactivity Human,Dog
Applications WB
Immunogen MMP23B antibody was raised using the N terminal of MMP23B corresponding to a region with amino acids ILSFPRNLLSPRETRRALAAAFRMWSDVSPFSFREVAPEQPSDLRIGFYP
Assay Information MMP23B Blocking Peptide, catalog no. 33R-4060, is also available for use as a blocking control in assays to test for specificity of this MMP23B antibody

Images

Western Blot analysis using MMP23B antibody (70R-6358)

MMP23B antibody (70R-6358) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 36 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MMP23B antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance MMP23B is a member of the matrix metalloproteinase (MMP) family, and it is part of a duplicated region of chromosome 1p36.3. Proteins of the matrix metalloproteinase (MMP) family are involved in the Breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using MMP23B antibody (70R-6358) | MMP23B antibody (70R-6358) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors