MMP3 antibody (70R-5294)

Rabbit polyclonal MMP3 antibody

Synonyms Polyclonal MMP3 antibody, Anti-MMP3 antibody, STR1 antibody, SL-1 antibody, Matrix Metallopeptidase 3 antibody, STMY antibody, MMP 3, Stromelysin 1 Progelatinase antibody, MGC126103 antibody, MGC126104 antibody, STMY1 antibody, MMP 3 antibody, MMP3, MMP 3 antibody, MMP-3, MGC126102 antibody, MMP-3 antibody, MMP-3 antibody
Cross Reactivity Human,Mouse,Dog
Applications WB
Immunogen MMP3 antibody was raised using a synthetic peptide corresponding to a region with amino acids AEDFPGIDSKIDAVFEEFGFFYFFTGSSQLEFDPNAKKVTHTLKSNSWLN
Assay Information MMP3 Blocking Peptide, catalog no. 33R-1118, is also available for use as a blocking control in assays to test for specificity of this MMP3 antibody

Images

Western Blot analysis using MMP3 antibody (70R-5294)

MMP3 antibody (70R-5294) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 43 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MMP3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance MMP3 can degrade fibronectin, laminin, gelatins of type I, III, IV, and V; collagens III, IV, X, and IX, and cartilage proteoglycans. MMP3 activates procollagenase.Proteins of the matrix metalloproteinase (MMP) family are involved in the Breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using MMP3 antibody (70R-5294) | MMP3 antibody (70R-5294) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors