MMP7 Blocking Peptide (33R-1053)

A synthetic peptide for use as a blocking control in assays to test for specificity of MMP7 antibody, catalog no. 70R-1557

Synonyms MMP7 control peptide, MMP7 antibody Blocking Peptide, Anti-MMP7 Blocking Peptide, Matrix Metallopeptidase 7 Blocking Peptide, Matrilysin Uterine Blocking Peptide, MMP-7 Blocking Peptide, MPSL1 Blocking Peptide, PUMP-1 Blocking Peptide, MMP7, MMP-7, MMP 7, MMP-7 Blocking Peptide, MMP 7 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues AATHELGHSLGMGHSSDPNAVMYPTYGNGDPQNFKLSQDDIKGIQKLYGK
Molecular Weight 19 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Proteins of the matrix metalloproteinase (MMP) family are involved in the Breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. MMP7 degrades proteoglycans, fibronectin, elastin and casein and differs from most MMP family members in that it lacks a conserved C-terminal protein domain. The enzyme is involved in wound healing, and studies in mice suggest that it regulates the activity of defensins in intestinal mucosa.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: $130.00
Size: 100 ug
OR
Shipping
View Our Distributors