MNS1 antibody (70R-2149)

Rabbit polyclonal MNS1 antibody raised against the middle region of MNS1

Synonyms Polyclonal MNS1 antibody, Anti-MNS1 antibody, MNS-1, Meiosis-Specific Nuclear Structural 1 antibody, FLJ11222 antibody, MNS 1 antibody, MNS-1 antibody, MNS1, MNS 1
Specificity MNS1 antibody was raised against the middle region of MNS1
Cross Reactivity Human
Applications WB
Immunogen MNS1 antibody was raised using the middle region of MNS1 corresponding to a region with amino acids KVQENEEKRLQLQNALTQKLEEMLRQREDLEQVRQELYQEEQAEIYKSKL
Assay Information MNS1 Blocking Peptide, catalog no. 33R-4719, is also available for use as a blocking control in assays to test for specificity of this MNS1 antibody

Images

Western Blot analysis using MNS1 antibody (70R-2149)

MNS1 antibody (70R-2149) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 60 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MNS1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes a protein highly similar to the mouse meiosis-specific nuclear structural 1 protein.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using MNS1 antibody (70R-2149) | MNS1 antibody (70R-2149) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors