MOGAT2 antibody (70R-6418)

Rabbit polyclonal MOGAT2 antibody raised against the middle region of MOGAT2

Synonyms Polyclonal MOGAT2 antibody, Anti-MOGAT2 antibody, MGC119185 antibody, MOGAT-2 antibody, DGAT2L5 antibody, MGC119183 antibody, MGAT2 antibody, Monoacylglycerol O-Acyltransferase 2 antibody, MGC119184 antibody, MOGAT-2, FLJ22644 antibody, MOGAT2, MOGAT 2, MOGAT 2 antibody
Specificity MOGAT2 antibody was raised against the middle region of MOGAT2
Cross Reactivity Human
Applications WB
Immunogen MOGAT2 antibody was raised using the middle region of MOGAT2 corresponding to a region with amino acids LLGIIVGGAQEALDARPGSFTLLLRNRKGFVRLALTHGAPLVPIFSFGEN
Assay Information MOGAT2 Blocking Peptide, catalog no. 33R-5142, is also available for use as a blocking control in assays to test for specificity of this MOGAT2 antibody

Images

Western Blot analysis using MOGAT2 antibody (70R-6418)

MOGAT2 antibody (70R-6418) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 38 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MOGAT2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Dietary fat absorption from the small intestine is facilitated by acyl-CoA:monoacylglycerol transferase (MOGAT) and acyl-CoA:diacylglycerol acyltransferase (DGAT) activities. MOGAT catalyzes the joining of monoacylglycerol and fatty acyl-CoAs to form diacylglycerol.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using MOGAT2 antibody (70R-6418) | MOGAT2 antibody (70R-6418) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors