MOS antibody (70R-5628)

Rabbit polyclonal MOS antibody raised against the middle region of MOS

Synonyms Polyclonal MOS antibody, Anti-MOS antibody, V-Mos Moloney Murine Sarcoma Viral Oncogene Homolog antibody, MGC119963 antibody, MSV antibody, MGC119962 antibody
Specificity MOS antibody was raised against the middle region of MOS
Cross Reactivity Human
Applications WB
Immunogen MOS antibody was raised using the middle region of MOS corresponding to a region with amino acids LNVARLRHDNIVRVVAASTRTPAGSNSLGTIIMEFGGNVTLHQVIYGAAG
Assay Information MOS Blocking Peptide, catalog no. 33R-5250, is also available for use as a blocking control in assays to test for specificity of this MOS antibody


Western Blot analysis using MOS antibody (70R-5628)

MOS antibody (70R-5628) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 38 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MOS antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance MOS is a serine/threonine kinase that activates the MAP kinase cascade through direct phosphorylation of the MAP kinase activator.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using MOS antibody (70R-5628) | MOS antibody (70R-5628) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors