MOSC1 antibody (70R-7354)

Rabbit polyclonal MOSC1 antibody raised against the C terminal of MOSC1

Synonyms Polyclonal MOSC1 antibody, Anti-MOSC1 antibody, MOSC1, MOSC-1, MOSC-1 antibody, RP11-295M18.1 antibody, Moco Sulphurase C-Terminal Domain Containing 1 antibody, MOSC 1, MOSC 1 antibody, FLJ22390 antibody
Specificity MOSC1 antibody was raised against the C terminal of MOSC1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen MOSC1 antibody was raised using the C terminal of MOSC1 corresponding to a region with amino acids WDELLIGDVELKRVMACSRCILTTVDPDTGVMSRKEPLETLKSYRQCDPS
Assay Information MOSC1 Blocking Peptide, catalog no. 33R-9937, is also available for use as a blocking control in assays to test for specificity of this MOSC1 antibody

Images

Western Blot analysis using MOSC1 antibody (70R-7354)

MOSC1 antibody (70R-7354) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 37 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MOSC1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance MOSC1 is a probable oxidoreductase.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using MOSC1 antibody (70R-7354) | MOSC1 antibody (70R-7354) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors