Motilin antibody (70R-6243)

Rabbit polyclonal Motilin antibody raised against the middle region of MLN

Synonyms Polyclonal Motilin antibody, Anti-Motilin antibody, MGC138519 antibody, MLN antibody
Specificity Motilin antibody was raised against the middle region of MLN
Cross Reactivity Human
Applications WB
Immunogen Motilin antibody was raised using the middle region of MLN corresponding to a region with amino acids LQRMQEKERNKGQKKSLSVWQRSGEEGPVDPAEPIREEENEMIKLTAPLE
Assay Information Motilin Blocking Peptide, catalog no. 33R-5335, is also available for use as a blocking control in assays to test for specificity of this Motilin antibody

Images

Western Blot analysis using Motilin antibody (70R-6243)

Motilin antibody (70R-6243) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 3 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MLN antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes a small peptide hormone that is secreted by cells of the small intestine to regulate gastrointestinal contractions and motility.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using Motilin antibody (70R-6243) | Motilin antibody (70R-6243) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors