MPDZ antibody (70R-2266)

Rabbit polyclonal MPDZ antibody raised against the middle region of MPDZ

Synonyms Polyclonal MPDZ antibody, Anti-MPDZ antibody, Multiple Pdz Domain Protein antibody, FLJ25909 antibody, FLJ34626 antibody, DKFZp781P216 antibody, MUPP1 antibody, FLJ90240 antibody
Specificity MPDZ antibody was raised against the middle region of MPDZ
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen MPDZ antibody was raised using the middle region of MPDZ corresponding to a region with amino acids DEAINVLRQTPQRVRLTLYRDEAPYKEEEVCDTLTIELQKKPGKGLGLSI
Assay Information MPDZ Blocking Peptide, catalog no. 33R-1891, is also available for use as a blocking control in assays to test for specificity of this MPDZ antibody

Images

Western blot analysis using MPDZ antibody (70R-2266)

Recommended MPDZ Antibody Titration: 0.2-1 ug/ml

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 218 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MPDZ antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance MPDZ Interacts with HTR2C and provokes its clustering at the cell surface (By similarity). It is a member of the NMDAR signaling complex that may play a role in control of AMPAR potentiation and synaptic plasticity in excitatory synapses.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western blot analysis using MPDZ antibody (70R-2266) | Recommended MPDZ Antibody Titration: 0.2-1 ug/ml
  • Immunohistochemical staining using MPDZ antibody (70R-2266) | Kidney
  • Western blot analysis using MPDZ antibody (70R-2266) | Lane 1: 30ug of HeLa cell lysate Lane 2: 30ug of 293T cell lysate MPDZ antibody at 1:2000

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors