MPEG1 antibody (70R-3787)

Rabbit polyclonal MPEG1 antibody raised against the middle region of MPEG1

Synonyms Polyclonal MPEG1 antibody, Anti-MPEG1 antibody, Macrophage Expressed Gene 1 antibody, MGC138435 antibody, MPEG-1, MPEG 1, MPEG-1 antibody, MPEG 1 antibody, MGC132657 antibody, MPEG1
Specificity MPEG1 antibody was raised against the middle region of MPEG1
Cross Reactivity Human
Applications WB
Immunogen MPEG1 antibody was raised using the middle region of MPEG1 corresponding to a region with amino acids TILAVVITLAIYGTRKFKKKAYQAIEERQSLVPGTAATGDTTYQEQGQSP
Assay Information MPEG1 Blocking Peptide, catalog no. 33R-9119, is also available for use as a blocking control in assays to test for specificity of this MPEG1 antibody

Images

Western Blot analysis using MPEG1 antibody (70R-3787)

MPEG1 antibody (70R-3787) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 78 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MPEG1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of MPEG1 protein is not widely studied, and is yet to be elucidated fully.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using MPEG1 antibody (70R-3787) | MPEG1 antibody (70R-3787) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors