MPPE1 antibody (70R-7157)

Rabbit polyclonal MPPE1 antibody raised against the N terminal of MPPE1

Synonyms Polyclonal MPPE1 antibody, Anti-MPPE1 antibody, Metallophosphoesterase 1 antibody, MPPE 1 antibody, MPPE-1, MPPE-1 antibody, MPPE 1, MPPE1
Specificity MPPE1 antibody was raised against the N terminal of MPPE1
Cross Reactivity Human,Mouse
Applications WB
Immunogen MPPE1 antibody was raised using the N terminal of MPPE1 corresponding to a region with amino acids WLLQPEVVFILGDIFDEGKWSTPEAWADDVERFQKMFRHPSHVQLKVVAG
Assay Information MPPE1 Blocking Peptide, catalog no. 33R-9972, is also available for use as a blocking control in assays to test for specificity of this MPPE1 antibody


Western Blot analysis using MPPE1 antibody (70R-7157)

MPPE1 antibody (70R-7157) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 40 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MPPE1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The specific function of MPPE1 is not yet known.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using MPPE1 antibody (70R-7157) | MPPE1 antibody (70R-7157) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors