MPV17L antibody (70R-3236)

Rabbit polyclonal MPV17L antibody raised against the N terminal of MPV17L

Synonyms Polyclonal MPV17L antibody, Anti-MPV17L antibody, MPVL-17 antibody, FLJ39599 antibody, MLPH1 antibody, MPVL 17 antibody, MLPH2 antibody, MPVL-17, Mpv17 Mitochondrial Membrane Protein-Like antibody, MGC70356 antibody, MPVL 17, MPV17L
Specificity MPV17L antibody was raised against the N terminal of MPV17L
Cross Reactivity Human
Applications WB
Immunogen MPV17L antibody was raised using the N terminal of MPV17L corresponding to a region with amino acids MAGWWPALSRAARRHPWPTNVLLYGSLVSAGDALQQRLQGREANWRQTRR
Assay Information MPV17L Blocking Peptide, catalog no. 33R-5673, is also available for use as a blocking control in assays to test for specificity of this MPV17L antibody

Images

Western Blot analysis using MPV17L antibody (70R-3236)

MPV17L antibody (70R-3236) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 17 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MPV17L antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Isoform 1 participates in reactive oxygen species metablism by up- or down-regulation of the genes of antioxidant enzymes.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using MPV17L antibody (70R-3236) | MPV17L antibody (70R-3236) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors