MPZL2 antibody (70R-6135)

Rabbit polyclonal MPZL2 antibody raised against the N terminal of MPZL2

Synonyms Polyclonal MPZL2 antibody, Anti-MPZL2 antibody, Myelin Protein Zero-Like 2 antibody, MPZL-2 antibody, MPZL-2, MPZL 2 antibody, EVA1 antibody, MPZL2, MPZL 2, EVA antibody
Specificity MPZL2 antibody was raised against the N terminal of MPZL2
Cross Reactivity Human, Mouse, Rat
Applications WB
Immunogen MPZL2 antibody was raised using the N terminal of MPZL2 corresponding to a region with amino acids LEAVNGTDARLKCTFSSFAPVGDALTVTWNFRPLDGGPEQFVFYYHIDPF
Assay Information MPZL2 Blocking Peptide, catalog no. 33R-4881, is also available for use as a blocking control in assays to test for specificity of this MPZL2 antibody

Images

Western Blot analysis using MPZL2 antibody (70R-6135)

MPZL2 antibody (70R-6135) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 22 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MPZL2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Epithelial V-like antigen (EVA) is expressed in thymus epithelium and strongly downregulated by thymocyte developmental progression. This gene is expressed in the thymus and in several epithelial structures early in embryogenesis.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using MPZL2 antibody (70R-6135) | MPZL2 antibody (70R-6135) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors