MRPL13 antibody (70R-3742)

Rabbit polyclonal MRPL13 antibody raised against the middle region of MRPL13

Synonyms Polyclonal MRPL13 antibody, Anti-MRPL13 antibody, MRPL-13, L13 antibody, MRPL 13, RPL13 antibody, MRPL-13 antibody, MRPL 13 antibody, MRPL13, Mitochondrial Ribosomal Protein L13 antibody, RPML13 antibody, L13mt antibody
Specificity MRPL13 antibody was raised against the middle region of MRPL13
Cross Reactivity Human
Applications WB
Immunogen MRPL13 antibody was raised using the middle region of MRPL13 corresponding to a region with amino acids AIYGMLPKNLHRRTMMERLHLFPDEYIPEDILKNLVEELPQPRKIPKRLD
Assay Information MRPL13 Blocking Peptide, catalog no. 33R-1286, is also available for use as a blocking control in assays to test for specificity of this MRPL13 antibody


Western Blot analysis using MRPL13 antibody (70R-3742)

MRPL13 antibody (70R-3742) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 21 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MRPL13 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using MRPL13 antibody (70R-3742) | MRPL13 antibody (70R-3742) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors