MRPL24 antibody (70R-4800)

Rabbit polyclonal MRPL24 antibody raised against the N terminal of MRPL24

Synonyms Polyclonal MRPL24 antibody, Anti-MRPL24 antibody, MGC22737 antibody, MRPL-24, MRPL-24 antibody, FLJ20917 antibody, MRPL24, MRP-L18 antibody, MRPL 24, MRPL 24 antibody, Mitochondrial Ribosomal Protein L24 antibody, MGC9831 antibody
Specificity MRPL24 antibody was raised against the N terminal of MRPL24
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen MRPL24 antibody was raised using the N terminal of MRPL24 corresponding to a region with amino acids RRRPVVVEPISDEDWYLFCGDTVEILEGKDAGKQGKVVQVIRQRNWVVVG
Assay Information MRPL24 Blocking Peptide, catalog no. 33R-8157, is also available for use as a blocking control in assays to test for specificity of this MRPL24 antibody

Images

Western Blot analysis using MRPL24 antibody (70R-4800)

MRPL24 antibody (70R-4800) used at 0.5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 25 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MRPL24 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. MRPL24 is a 39S subunit protein which is more than twice the size of its E.coli counterpart (EcoL24).

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using MRPL24 antibody (70R-4800) | MRPL24 antibody (70R-4800) used at 0.5 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors