MRPL47 antibody (70R-5314)

Rabbit polyclonal MRPL47 antibody raised against the middle region of MRPL47

Synonyms Polyclonal MRPL47 antibody, Anti-MRPL47 antibody, MRPL-47, CGI-204 antibody, MRPL 47 antibody, MRPL 47, MGC45403 antibody, MRPL47, MRPL-47 antibody, NCM1 antibody, Mitochondrial Ribosomal Protein L47 antibody
Specificity MRPL47 antibody was raised against the middle region of MRPL47
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen MRPL47 antibody was raised using the middle region of MRPL47 corresponding to a region with amino acids VVQEREDALRLLQTGQERARPGAWRRDIFGRIIWHKFKQWVIPWHLNKRY
Assay Information MRPL47 Blocking Peptide, catalog no. 33R-9890, is also available for use as a blocking control in assays to test for specificity of this MRPL47 antibody

Images

Western Blot analysis using MRPL47 antibody (70R-5314)

MRPL47 antibody (70R-5314) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 17 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MRPL47 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using MRPL47 antibody (70R-5314) | MRPL47 antibody (70R-5314) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors