MRPS12 antibody (70R-2407)

Rabbit polyclonal MRPS12 antibody raised against the N terminal of MRPS12

Synonyms Polyclonal MRPS12 antibody, Anti-MRPS12 antibody, RPSM12 antibody, MT-RPS12 antibody, Mitochondrial Ribosomal Protein S12 antibody, RPMS12 antibody, MRPS 12 antibody, MPR-S12 antibody, MRPS12, MRPS-12, RPS12 antibody, MRPS 12, MRPS-12 antibody
Specificity MRPS12 antibody was raised against the N terminal of MRPS12
Cross Reactivity Human
Applications WB
Immunogen MRPS12 antibody was raised using the N terminal of MRPS12 corresponding to a region with amino acids LVPRLWATCSMATLNQMHRLGPPKRPPRKLGPTEGRPQLKGVVLCTFTRK
Assay Information MRPS12 Blocking Peptide, catalog no. 33R-5533, is also available for use as a blocking control in assays to test for specificity of this MRPS12 antibody

Images

Western Blot analysis using MRPS12 antibody (70R-2407)

MRPS12 antibody (70R-2407) used at 0.5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 12 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MRPS12 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. MRPS12 is the 28S subunit protein that belongs to the ribosomal protein S12P family. The protein is a key component of the ribosomal small subunit and controls the decoding fidelity and susceptibility to aminoglycoside antibiotics.Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using MRPS12 antibody (70R-2407) | MRPS12 antibody (70R-2407) used at 0.5 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors