MRPS6 antibody (70R-4457)

Rabbit polyclonal MRPS6 antibody raised against the middle region of MRPS6

Synonyms Polyclonal MRPS6 antibody, Anti-MRPS6 antibody, MRPS-6 antibody, MRPS 6 antibody, MRP-S6 antibody, Mitochondrial Ribosomal Protein S6 antibody, C21orf101 antibody, MRPS6, RPMS6 antibody, MRPS 6, MRPS-6
Specificity MRPS6 antibody was raised against the middle region of MRPS6
Cross Reactivity Human
Applications WB
Immunogen MRPS6 antibody was raised using the middle region of MRPS6 corresponding to a region with amino acids VESMVEHLSRDIDVIRGNIVKHPLTQELKECEGIVPVPLAEKLYSTKKRK
Assay Information MRPS6 Blocking Peptide, catalog no. 33R-9511, is also available for use as a blocking control in assays to test for specificity of this MRPS6 antibody

Images

Western Blot analysis using MRPS6 antibody (70R-4457)

MRPS6 antibody (70R-4457) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 14 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MRPS6 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using MRPS6 antibody (70R-4457) | MRPS6 antibody (70R-4457) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors