MRS2L antibody (70R-6521)

Rabbit polyclonal MRS2L antibody raised against the middle region of Mrs2L

Synonyms Polyclonal MRS2L antibody, Anti-MRS2L antibody, MRSL 2, MRSL 2 antibody, HPT antibody, MRSL-2, MRSL-2 antibody, MRS2L, MRS2 antibody, MGC78523 antibody
Specificity MRS2L antibody was raised against the middle region of Mrs2L
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen MRS2L antibody was raised using the middle region of Mrs2L corresponding to a region with amino acids LDALVDPKHSSVDRSKLHILLQNGKSLSELETDIKIFKESILEILDEEEL
Assay Information MRS2L Blocking Peptide, catalog no. 33R-4838, is also available for use as a blocking control in assays to test for specificity of this MRS2L antibody

Images

Western Blot analysis using MRS2L antibody (70R-6521)

MRS2L antibody (70R-6521) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 50 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MRS2L antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance MRS2L is a magnesium transporter that may mediate the influx of magnesium into the mitochondrial matrix.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using MRS2L antibody (70R-6521) | MRS2L antibody (70R-6521) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors