MRTO4 antibody (70R-1198)

Rabbit polyclonal MRTO4 antibody

Synonyms Polyclonal MRTO4 antibody, Anti-MRTO4 antibody, C1orf33 antibody, MRTO-4 antibody, dJ657E11.4 antibody, MRTO4, MRTO 4 antibody, MRTO 4, mRNA Turnover 4 Homolog antibody, MRTO-4, MRT4 antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen MRTO4 antibody was raised using a synthetic peptide corresponding to a region with amino acids SKLKDIRNAWKHSRMFFGKNKVMMVALGRSPSDEYKDNLHQVSKRLRGEV
Assay Information MRTO4 Blocking Peptide, catalog no. 33R-8557, is also available for use as a blocking control in assays to test for specificity of this MRTO4 antibody

Images

Western Blot analysis using MRTO4 antibody (70R-1198)

MRTO4 antibody (70R-1198) used at 2.5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 27 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of MRTO4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance MRTO4 is a protein sharing a low level of sequence similarity with ribosomal protein P0. While the precise function of the protein is currently unknown, it appears to be involved in mRNA turnover and ribosome assembly.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using MRTO4 antibody (70R-1198) | MRTO4 antibody (70R-1198) used at 2.5 ug/ml to detect target protein.

Availability: In stock

Price: $275.00
Size: 100 ug
OR
Shipping
View Our Distributors