MS4A4A antibody (70R-6928)

Rabbit polyclonal MS4A4A antibody raised against the N terminal of MS4A4A

Synonyms Polyclonal MS4A4A antibody, Anti-MS4A4A antibody, MS4A4 antibody, MSAA-4, MSAA-4 antibody, CD20-L1 antibody, 4SPAN1 antibody, MS4A4A, CD20L1 antibody, MS4A7 antibody, Membrane-Spanning 4-Domains Subfamily A Member 4 antibody, MSAA 4, MGC22311 antibody, MSAA 4 antibody, HDCME31P antibody
Specificity MS4A4A antibody was raised against the N terminal of MS4A4A
Cross Reactivity Human
Applications WB
Immunogen MS4A4A antibody was raised using the N terminal of MS4A4A corresponding to a region with amino acids MHQTYSRHCRPEESTFSAAMTTMQGMEQAMPGAGPGVPQLGNMAVIHSHL
Assay Information MS4A4A Blocking Peptide, catalog no. 33R-6100, is also available for use as a blocking control in assays to test for specificity of this MS4A4A antibody

Images

Western Blot analysis using MS4A4A antibody (70R-6928)

MS4A4A antibody (70R-6928) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 26 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MS4A4A antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance MS4A4A is a member of the membrane-spanning 4A gene family. Members of this nascent protein family are characterized by common structural features and similar intron/exon splice boundaries and display unique expression patterns among hematopoietic cells and nonlymphoid tissues.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using MS4A4A antibody (70R-6928) | MS4A4A antibody (70R-6928) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors