MSH2 antibody (70R-1634)

Rabbit polyclonal MSH2 antibody

Synonyms Polyclonal MSH2 antibody, Anti-MSH2 antibody, Muts Homolog 2 Colon Cancer Nonpolyposis Type 1 antibody, MSH 2 antibody, MSH-2 antibody, MSH-2, MSH2, MSH 2
Cross Reactivity Human,Rat,Dog,ZebraFish
Applications WB
Immunogen MSH2 antibody was raised using a synthetic peptide corresponding to a region with amino acids KMSAVDGQRQVGVGYVDSIQRKLGLCEFPDNDQFSNLEALLIQIGPKECV
Assay Information MSH2 Blocking Peptide, catalog no. 33R-4562, is also available for use as a blocking control in assays to test for specificity of this MSH2 antibody


Western Blot analysis using MSH2 antibody (70R-1634)

MSH2 antibody (70R-1634) used at 1.25 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 64 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of MSH2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance MSH2 was identified as a locus frequently mutated in hereditary nonpolyposis colon cancer (HNPCC). When cloned, it was discovered to be a human homolog of the E. coli mismatch repair gene mutS, consistent with the characteristic alterations in microsatellite sequences (RER+ phenotype) found in HNPCC.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using MSH2 antibody (70R-1634) | MSH2 antibody (70R-1634) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: $275.00
Size: 100 ug
View Our Distributors