MSH2 antibody (70R-5689)

Rabbit polyclonal MSH2 antibody

Synonyms Polyclonal MSH2 antibody, Anti-MSH2 antibody, MSH 2 antibody, HNPCC1 antibody, HNPCC antibody, MSH-2, MSH-2 antibody, FCC1 antibody, MSH 2, COCA1 antibody, MSH2, Muts Homolog 2 Colon Cancer Nonpolyposis Type 1 antibody
Cross Reactivity Human,Rat
Applications WB
Immunogen MSH2 antibody was raised using a synthetic peptide corresponding to a region with amino acids GNKASKENDWYLAYKASPGNLSQFEDILFGNNDMSASIGVVGVKMSAVDG
Assay Information MSH2 Blocking Peptide, catalog no. 33R-3449, is also available for use as a blocking control in assays to test for specificity of this MSH2 antibody


Western Blot analysis using MSH2 antibody (70R-5689)

MSH2 antibody (70R-5689) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 105 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MSH2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance MSH2 was identified as a locus frequently mutated in hereditary nonpolyposis colon cancer (HNPCC). When cloned, it was discovered to be a human homolog of the E. coli mismatch repair gene mutS, consistent with the characteristic alterations in microsatellite sequences (RER+ phenotype) found in HNPCC. MSH2 was identified as a locus frequently mutated in hereditary nonpolyposis colon cancer (HNPCC). When cloned, it was discovered to be a human homolog of the E. coli mismatch repair gene mutS, consistent with the characteristic alterations in microsatellite sequences (RER+ phenotype) found in HNPCC.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using MSH2 antibody (70R-5689) | MSH2 antibody (70R-5689) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors