MSRA antibody (70R-3994)

Rabbit polyclonal MSRA antibody raised against the middle region of MSRA

Synonyms Polyclonal MSRA antibody, Anti-MSRA antibody, Methionine Sulfoxide Reductase A antibody
Specificity MSRA antibody was raised against the middle region of MSRA
Cross Reactivity Human
Applications WB
Immunogen MSRA antibody was raised using the middle region of MSRA corresponding to a region with amino acids YQKVLSEHGFGPITTDIREGQTFYYAEDYHQQYLSKNPNGYCGLGGTGVS
Assay Information MSRA Blocking Peptide, catalog no. 33R-10213, is also available for use as a blocking control in assays to test for specificity of this MSRA antibody


Western Blot analysis using MSRA antibody (70R-3994)

MSRA antibody (70R-3994) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 26 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MSRA antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This protein is ubiquitous and highly conserved. It carries out the enzymatic reduction of methionine sulfoxide to methionine. Human and animal studies have shown the highest levels of expression in kidney and nervous tissue. Its proposed function is the repair of oxidative damage to proteins to restore biological activity. Three transcript variants encoding different isoforms have been found for this gene.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using MSRA antibody (70R-3994) | MSRA antibody (70R-3994) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors