MST1 antibody (70R-5281)

Rabbit polyclonal MST1 antibody

Synonyms Polyclonal MST1 antibody, Anti-MST1 antibody, HGFL antibody, NF15S2 antibody, Hepatocyte Growth Factor-Like antibody, MST-1, MST 1, D3F15S2 antibody, MST1, Macrophage Stimulating 1 antibody, MST-1 antibody, DNF15S2 antibody, MST 1 antibody, MSP antibody
Cross Reactivity Human
Applications WB
Immunogen MST1 antibody was raised using a synthetic peptide corresponding to a region with amino acids SCHMPLTGYEVWLGTLFQNPQHGEPSLQRVPVAKMVCGPSGSQLVLLKLE
Assay Information MST1 Blocking Peptide, catalog no. 33R-8329, is also available for use as a blocking control in assays to test for specificity of this MST1 antibody


Western Blot analysis using MST1 antibody (70R-5281)

MST1 antibody (70R-5281) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 80 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MST1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance MST1 belongs to the peptidase S1 family, plasminogen subfamily. It contains 4 kringle domains, 1 PAN domain and 1 peptidase S1 domain. MST1 probably has no proteolytic activity, since crucial characteristic of serine proteases catalytic sites are not conserved.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using MST1 antibody (70R-5281) | MST1 antibody (70R-5281) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors