MTCH1 antibody (70R-7138)

Rabbit polyclonal MTCH1 antibody

Synonyms Polyclonal MTCH1 antibody, Anti-MTCH1 antibody, MTCH1, PSAP antibody, MTCH 1, MTCH-1, MTCH 1 antibody, Mitochondrial Carrier Homolog 1 antibody, PIG60 antibody, MTCH-1 antibody, CGI-64 antibody, MGC131998 antibody
Cross Reactivity Human, Mouse, Rat
Applications WB
Immunogen MTCH1 antibody was raised using a synthetic peptide corresponding to a region with amino acids NNCGLQAGLPPYSPVFKSWIHCWKYLSVQGQLFRGSSLLFRRVSSGSCFA
Assay Information MTCH1 Blocking Peptide, catalog no. 33R-6803, is also available for use as a blocking control in assays to test for specificity of this MTCH1 antibody


Western Blot analysis using MTCH1 antibody (70R-7138)

MTCH1 antibody (70R-7138) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 40 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MTCH1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance MTCH1 is a potential mitochondrial transporter. It may play a role in apoptosis.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using MTCH1 antibody (70R-7138) | MTCH1 antibody (70R-7138) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors