MTHFD1 antibody (70R-2357)

Rabbit polyclonal MTHFD1 antibody

Synonyms Polyclonal MTHFD1 antibody, Anti-MTHFD1 antibody, MTHFD-1 antibody, Nadp+ Dependent 1 Methenyltetrahydrofolate Cyclohydrolase Formyltetrahydrofolate Synthetase antibody, MTHFD-1, MTHFD1, MTHFD 1, Methylenetetrahydrofolate Dehydrogenase antibody, MTHFC antibody, MTHFD antibody, MTHFD 1 antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen MTHFD1 antibody was raised using a synthetic peptide corresponding to a region with amino acids RTTTESEVMKYITSLNEDSTVHGFLVQLPLDSENSINTEEVINAIAPEKD
Assay Information MTHFD1 Blocking Peptide, catalog no. 33R-8236, is also available for use as a blocking control in assays to test for specificity of this MTHFD1 antibody

Images

Western blot analysis using MTHFD1 antibody (70R-2357)

Recommended MTHFD1 Antibody Titration: 0.2-1 ug/ml

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 101 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MTHFD1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance MTHFD1 possesses three distinct enzymatic activities, 5,10-methylenetetrahydrofolate dehydrogenase, 5,10-methenyltetrahydrofolate cyclohydrolase and 10-formyltetrahydrofolate synthetase. Each of these activities catalyzes one of three sequential reactions in the interconversion of 1-carbon derivatives of tetrahydrofolate, which are substrates for methionine, thymidylate, and de novo purine syntheses. The trifunctional enzymatic activities are conferred by two major domains, an aminoterminal portion containing the dehydrogenase and cyclohydrolase activities and a larger synthetase domain.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western blot analysis using MTHFD1 antibody (70R-2357) | Recommended MTHFD1 Antibody Titration: 0.2-1 ug/ml
  • Immunohistochemical staining using MTHFD1 antibody (70R-2357) | Liver

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors