MTHFD2 antibody (70R-1091)

Rabbit polyclonal MTHFD2 antibody

Synonyms Polyclonal MTHFD2 antibody, Anti-MTHFD2 antibody, MTHFD2, NMDMC antibody, Nadp+ Dependent 2 antibody, MTHFD 2 antibody, MTHFD-2, Methylenetetrahydrofolate Dehydrogenase antibody, MTHFD-2 antibody, MTHFD 2
Cross Reactivity Human,Mouse,Rat,Dog
Applications WB
Immunogen MTHFD2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LPLPEHIDERRICNAVSPDKDVDGFHVINVGRMCLDQYSMLPATPWGVWE
Assay Information MTHFD2 Blocking Peptide, catalog no. 33R-5273, is also available for use as a blocking control in assays to test for specificity of this MTHFD2 antibody


Western Blot analysis using MTHFD2 antibody (70R-1091)

MTHFD2 antibody (70R-1091) used at 1.25 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 35 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of MTHFD2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance MTHFD2 is a nuclear-encoded mitochondrial bifunctional enzyme with methylenetetrahydrofolate dehydrogenase and methenyltetrahydrofolate cyclohydrolase activities. The enzyme functions as a homodimer and is unique in its absolute requirement for magnesium and inorganic phosphate. Formation of the enzyme-magnesium complex allows binding of NAD.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using MTHFD2 antibody (70R-1091) | MTHFD2 antibody (70R-1091) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: $275.00
Size: 100 ug
View Our Distributors