MTHFS antibody (70R-3776)

Rabbit polyclonal MTHFS antibody

Synonyms Polyclonal MTHFS antibody, Anti-MTHFS antibody, 5-10-Methenyltetrahydrofolate Synthetase antibody, FLJ30410 antibody, HsT19268 antibody, 5-Formyltetrahydrofolate Cyclo-Ligase antibody
Cross Reactivity Human
Applications WB
Immunogen MTHFS antibody was raised using a synthetic peptide corresponding to a region with amino acids TSWNIPQPGEGDVREEALSTGGLDLIFMPGLGFDKHGNRLGRGKGYYDAY
Assay Information MTHFS Blocking Peptide, catalog no. 33R-9306, is also available for use as a blocking control in assays to test for specificity of this MTHFS antibody


Western Blot analysis using MTHFS antibody (70R-3776)

MTHFS antibody (70R-3776) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 23 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MTHFS antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance MTHFS contributes to tetrahydrofolate metabolism. It helps regulate carbon flow through the folate-dependent one-carbon metabolic network that supplies carbon for the biosynthesis of purines, thymidine and amino acids.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using MTHFS antibody (70R-3776) | MTHFS antibody (70R-3776) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors