MTHFSD antibody (70R-4964)

Rabbit polyclonal MTHFSD antibody raised against the N terminal of MTHFSD

Synonyms Polyclonal MTHFSD antibody, Anti-MTHFSD antibody, MGC138262 antibody, FLJ12998 antibody, MGC138264 antibody, Methenyltetrahydrofolate Synthetase Domain Containing antibody, FLJ13893 antibody
Specificity MTHFSD antibody was raised against the N terminal of MTHFSD
Cross Reactivity Human
Applications WB
Immunogen MTHFSD antibody was raised using the N terminal of MTHFSD corresponding to a region with amino acids MEPRAGVSKQDIREQIWGYMESQNLADFPRPVHHRIPNFKGSYLACQNIK
Assay Information MTHFSD Blocking Peptide, catalog no. 33R-5945, is also available for use as a blocking control in assays to test for specificity of this MTHFSD antibody


Western Blot analysis using MTHFSD antibody (70R-4964)

MTHFSD antibody (70R-4964) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 42 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MTHFSD antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function remains unknows.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using MTHFSD antibody (70R-4964) | MTHFSD antibody (70R-4964) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors