MTMR14 antibody (70R-3995)

Rabbit polyclonal MTMR14 antibody raised against the middle region of MTMR14

Synonyms Polyclonal MTMR14 antibody, Anti-MTMR14 antibody, FLJ90311 antibody, MTMR-14, MTMR 14, MTMR-14 antibody, Myotubularin Related Protein 14 antibody, hEDTP antibody, MTMR14, FLJ22405 antibody, MTMR 14 antibody, C3orf29 antibody
Specificity MTMR14 antibody was raised against the middle region of MTMR14
Cross Reactivity Human
Applications WB
Immunogen MTMR14 antibody was raised using the middle region of MTMR14 corresponding to a region with amino acids NFLKHITSEEFSALKTQRRKSLPARDGGFTLEDICMLRRKDRGSTTSLGS
Assay Information MTMR14 Blocking Peptide, catalog no. 33R-6688, is also available for use as a blocking control in assays to test for specificity of this MTMR14 antibody

Images

Western Blot analysis using MTMR14 antibody (70R-3995)

MTMR14 antibody (70R-3995) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 72 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MTMR14 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes a myotubularin-related protein. The encoded protein is a phosphoinositide phosphatase that specifically dephosphorylates phosphatidylinositol 3,5-biphosphate and phosphatidylinositol 3-phosphate. Mutations in this gene are correlated with autosomal dominant centronuclear myopathy. Alternate splicing results in multiple transcript variants. A pseudogene of this gene is found on chromosome 18.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using MTMR14 antibody (70R-3995) | MTMR14 antibody (70R-3995) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors